PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H01254.1.p
Common NameEUGRSUZ_H01254
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 184aa    MW: 20705.3 Da    PI: 5.946
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H01254.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.91.1e-2059112356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        ++++t+eq+e Le+ F  ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Eucgr.H01254.1.p  59 GKRKLTAEQVELLEQNFGDEHKLESERKDRLAAELGLDPRQVAVWFQNRRARWK 112
                       56799************************************************9 PP

2HD-ZIP_I/II118.92.8e-3860150393
       HD-ZIP_I/II   3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       kr+l++eqv+lLE++F  e+kLe+erK +la eLgl+prqvavWFqnrRAR+k+k+lE++y++Lk+ +++++ e++r+e+ev +L+e+l+e
  Eucgr.H01254.1.p  60 KRKLTAEQVELLEQNFGDEHKLESERKDRLAAELGLDPRQVAVWFQNRRARWKSKKLEVEYAKLKSVHETVVVEKCRFESEVLKLKEQLSE 150
                       9***************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.96E-1851115IPR009057Homeodomain-like
PROSITE profilePS5007117.31354114IPR001356Homeobox domain
SMARTSM003892.5E-1957118IPR001356Homeobox domain
PfamPF000465.9E-1859112IPR001356Homeobox domain
CDDcd000862.72E-1660115No hitNo description
Gene3DG3DSA:1.10.10.603.4E-2161120IPR009057Homeodomain-like
PRINTSPR000317.3E-68594IPR000047Helix-turn-helix motif
PROSITE patternPS00027089112IPR017970Homeobox, conserved site
PRINTSPR000317.3E-694110IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MNDLSEDDMA LISELYPGVY MRPSPPPQEA KPPRRRRKKS RGLENPGEEG GGTGGEGRGK  60
RKLTAEQVEL LEQNFGDEHK LESERKDRLA AELGLDPRQV AVWFQNRRAR WKSKKLEVEY  120
AKLKSVHETV VVEKCRFESE VLKLKEQLSE AEMEIKRLSE KADLGLSGNS PCSSVTADAA  180
TDDP
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H01254.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010070037.11e-131PREDICTED: homeobox-leucine zipper protein ATHB-40
SwissprotQ9ZU702e-64ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLA0A059AXW81e-132A0A059AXW8_EUCGR; Uncharacterized protein (Fragment)
STRINGPOPTR_0005s12760.13e-65(Populus trichocarpa)
STRINGfgenesh2_kg.7__393__AT4G36740.15e-65(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22082677
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18550.12e-54homeobox protein 21